PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr027935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NF-YB
Protein Properties Length: 238aa    MW: 26877.5 Da    PI: 6.9565
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr027935.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.65.7e-5654149297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  +eqdrflPianv+rimkkv+P+n+kiskdaketvqecvsefisfvt+easdkcqrekrkting+d++wa++tlGfedyv+plk yl++yr+legek
  Pbr027935.1  54 KEQDRFLPIANVGRIMKKVIPGNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGEDIIWAITTLGFEDYVHPLKSYLHRYRDLEGEK 149
                  89*******************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-5349176IPR009072Histone-fold
SuperFamilySSF471131.44E-4056180IPR009072Histone-fold
PfamPF008082.5E-2859123IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.8E-1987105No hitNo description
PROSITE patternPS00685090106IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006155.8E-19106124No hitNo description
PRINTSPR006155.8E-19125143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MQRETDDERL YVPSGGGGSP ETPCSLKSST TATACASASN NNNNNHHHNN HHNKEQDRFL  60
PIANVGRIMK KVIPGNGKIS KDAKETVQEC VSEFISFVTG EASDKCQREK RKTINGEDII  120
WAITTLGFED YVHPLKSYLH RYRDLEGEKL NVPKQQRSEQ RLHQQQQQPD QQDHRNQTLL  180
PYDNNSSSSV YSSTTNVMSQ PSFMADHHQA FSLPFSPSSI QKQFQPQQDQ IDSVGHW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4454144292Transcription factor HapC (Eurofung)
4g92_B3e-4454144292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009355897.11e-180PREDICTED: nuclear transcription factor Y subunit B-7
SwissprotQ9SIT96e-71NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLM5X2206e-93M5X220_PRUPE; Uncharacterized protein
STRINGGLYMA05G32680.18e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132492430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.19e-63nuclear factor Y, subunit B7